SCOPe 2.02: Domain d1hmua3: 1hmu A:336-599

Lineage for d1hmua3 (1hmu A:336-599)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.30: Supersandwich [49993] (3 superfamilies)
   sandwich; 18 strands in 2 sheets

4. Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families)
   probable carbohydrate-binding domain in enzymes acting on sugars

5. Family b.30.5.2: Hyaluronate lyase-like, central domain [50006] (4 proteins)

6. Protein Chondroitinase AC [50007] (2 species)

7. Species Pedobacter heparinus (Flavobacterium heparinum) [TaxId:984] [50008] (5 PDB entries)

8. Domain d1hmua3: 1hmu A:336-599 [61091]
   Other proteins in same PDB: d1hmua1, d1hmua2
   complexed with ca

Details for d1hmua3

PDB Entry: 1hmu, 2 Å

PDB Description: active site of chondroitinase ac lyase revealed by the structure of enzyme-oligosaccharide complexes and mutagenesis

PDB Compounds: (A:) chondroitinase ac

SCOPe Domain Sequences for d1hmua3:

Sequence; same for both SEQRES and ATOM records:

>d1hmua3 b.30.5.2 (A:336-599) Chondroitinase AC {Pedobacter heparinus (Flavobacterium heparinum) [TaxId: 984]}
iepyhhqfwngdyvqhlrpaysfnvrmvskrtrrsesgnkenllgrylsdgatniqlrgp
eyynimpvwewdkipgitsrdyltdrpltklwgeqgsndfaggvsdgvygasayaldyds
lqakkawfffdkeivclgaginsnapenitttlnqswlngpvistagktgrgkittfkaq
gqfwllhdaigyyfpeganlslstqsqkgnwfhinnshskdevsgdvfklwinhgarpen
aqyayivlpginkpeeikkyngta

Timeline for d1hmua3:

• d1hmua3 first appeared in SCOP 1.57
  
• d1hmua3 appears in SCOPe 2.01
  
• d1hmua3 appears in SCOPe 2.03
  
• d1hmua3 appears in the current release, SCOPe 2.08