Lineage for d1hmua3 (1hmu A:336-599)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 227198Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 227254Superfamily b.30.5: Galactose mutarotase-like [74650] (5 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 227382Family b.30.5.2: Hyaluronate lyase-like, central domain [50006] (2 proteins)
  6. 227383Protein Chondroitinase AC [50007] (1 species)
  7. 227384Species Pedobacter heparinus (Flavobacterium heparinum) [TaxId:984] [50008] (5 PDB entries)
  8. 227386Domain d1hmua3: 1hmu A:336-599 [61091]
    Other proteins in same PDB: d1hmua1, d1hmua2
    complexed with ca, gcu, idt, man, mxy, ngl, ram, xys; mutant

Details for d1hmua3

PDB Entry: 1hmu (more details), 2 Å

PDB Description: active site of chondroitinase ac lyase revealed by the structure of enzyme-oligosaccharide complexes and mutagenesis

SCOP Domain Sequences for d1hmua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hmua3 b.30.5.2 (A:336-599) Chondroitinase AC {Pedobacter heparinus (Flavobacterium heparinum)}
iepyhhqfwngdyvqhlrpaysfnvrmvskrtrrsesgnkenllgrylsdgatniqlrgp
eyynimpvwewdkipgitsrdyltdrpltklwgeqgsndfaggvsdgvygasayaldyds
lqakkawfffdkeivclgaginsnapenitttlnqswlngpvistagktgrgkittfkaq
gqfwllhdaigyyfpeganlslstqsqkgnwfhinnshskdevsgdvfklwinhgarpen
aqyayivlpginkpeeikkyngta

SCOP Domain Coordinates for d1hmua3:

Click to download the PDB-style file with coordinates for d1hmua3.
(The format of our PDB-style files is described here.)

Timeline for d1hmua3: