Lineage for d1hmua3 (1hmu A:336-599)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781620Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2781847Family b.30.5.2: Hyaluronate lyase-like, central domain [50006] (4 proteins)
    automatically mapped to Pfam PF02278
  6. 2781851Protein Chondroitinase AC [50007] (2 species)
  7. 2781859Species Pedobacter heparinus (Flavobacterium heparinum) [TaxId:984] [50008] (5 PDB entries)
  8. 2781862Domain d1hmua3: 1hmu A:336-599 [61091]
    Other proteins in same PDB: d1hmua1, d1hmua2
    complexed with ca

Details for d1hmua3

PDB Entry: 1hmu (more details), 2 Å

PDB Description: active site of chondroitinase ac lyase revealed by the structure of enzyme-oligosaccharide complexes and mutagenesis
PDB Compounds: (A:) chondroitinase ac

SCOPe Domain Sequences for d1hmua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hmua3 b.30.5.2 (A:336-599) Chondroitinase AC {Pedobacter heparinus (Flavobacterium heparinum) [TaxId: 984]}
iepyhhqfwngdyvqhlrpaysfnvrmvskrtrrsesgnkenllgrylsdgatniqlrgp
eyynimpvwewdkipgitsrdyltdrpltklwgeqgsndfaggvsdgvygasayaldyds
lqakkawfffdkeivclgaginsnapenitttlnqswlngpvistagktgrgkittfkaq
gqfwllhdaigyyfpeganlslstqsqkgnwfhinnshskdevsgdvfklwinhgarpen
aqyayivlpginkpeeikkyngta

SCOPe Domain Coordinates for d1hmua3:

Click to download the PDB-style file with coordinates for d1hmua3.
(The format of our PDB-style files is described here.)

Timeline for d1hmua3: