Lineage for d1hmua2 (1hmu A:600-699)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 793854Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (1 superfamily)
    sandwich, 10 strands in 2 sheets; "folded meander"
  4. 793855Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (1 family) (S)
  5. 793856Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (4 proteins)
  6. 793860Protein Chondroitinase AC [49865] (2 species)
  7. 793868Species Pedobacter heparinus (Flavobacterium heparinum) [TaxId:984] [49866] (5 PDB entries)
  8. 793870Domain d1hmua2: 1hmu A:600-699 [61090]
    Other proteins in same PDB: d1hmua1, d1hmua3
    complexed with ca, gcu, idt, man, mxy, ngl, ram, xys; mutant

Details for d1hmua2

PDB Entry: 1hmu (more details), 2 Å

PDB Description: active site of chondroitinase ac lyase revealed by the structure of enzyme-oligosaccharide complexes and mutagenesis
PDB Compounds: (A:) chondroitinase ac

SCOP Domain Sequences for d1hmua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hmua2 b.24.1.1 (A:600-699) Chondroitinase AC {Pedobacter heparinus (Flavobacterium heparinum) [TaxId: 984]}
pkvlantnqlqavyhqqldmvqaifytagklsvagieietdkpcavlikhingkqviwaa
dplqkektavlsirdlktgktnrvkidfpqqefagatvel

SCOP Domain Coordinates for d1hmua2:

Click to download the PDB-style file with coordinates for d1hmua2.
(The format of our PDB-style files is described here.)

Timeline for d1hmua2: