SCOPe 2.05: Domain d1hm3a3: 1hm3 A:336-599

Lineage for d1hm3a3 (1hm3 A:336-599)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.30: Supersandwich [49993] (3 superfamilies)
   sandwich; 18 strands in 2 sheets

4. Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families)
   probable carbohydrate-binding domain in enzymes acting on sugars

5. Family b.30.5.2: Hyaluronate lyase-like, central domain [50006] (4 proteins)
   automatically mapped to Pfam PF02278

6. Protein Chondroitinase AC [50007] (2 species)

7. Species Pedobacter heparinus (Flavobacterium heparinum) [TaxId:984] [50008] (5 PDB entries)

8. Domain d1hm3a3: 1hm3 A:336-599 [61088]
   Other proteins in same PDB: d1hm3a1, d1hm3a2
   complexed with ca

Details for d1hm3a3

PDB Entry: 1hm3, 2.1 Å

PDB Description: active site of chondroitinase ac lyase revealed by the structure of enzyme-oligosaccharide complexes and mutagenesis

PDB Compounds: (A:) chondroitinase ac

SCOPe Domain Sequences for d1hm3a3:

Sequence; same for both SEQRES and ATOM records:

>d1hm3a3 b.30.5.2 (A:336-599) Chondroitinase AC {Pedobacter heparinus (Flavobacterium heparinum) [TaxId: 984]}
iepyhhqfwngdyvqhlrpaysfnvrmvskrtrrsesgnkenllgrylsdgatniqlrgp
eyynimpvwewdkipgitsrdyltdrpltklwgeqgsndfaggvsdgvygasayaldyds
lqakkawfffdkeivclgaginsnapenitttlnqswlngpvistagktgrgkittfkaq
gqfwllhdaigyyfpeganlslstqsqkgnwfhinnshskdevsgdvfklwinhgarpen
aqyayivlpginkpeeikkyngta

Timeline for d1hm3a3:

• d1hm3a3 first appeared in SCOP 1.57
  
• d1hm3a3 appears in SCOPe 2.04
  
• d1hm3a3 appears in SCOPe 2.06
  
• d1hm3a3 appears in the current release, SCOPe 2.08