Lineage for d1hm3a3 (1hm3 A:336-599)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 295197Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 295253Superfamily b.30.5: Galactose mutarotase-like [74650] (8 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 295381Family b.30.5.2: Hyaluronate lyase-like, central domain [50006] (4 proteins)
  6. 295385Protein Chondroitinase AC [50007] (1 species)
  7. 295386Species Pedobacter heparinus (Flavobacterium heparinum) [TaxId:984] [50008] (5 PDB entries)
  8. 295390Domain d1hm3a3: 1hm3 A:336-599 [61088]
    Other proteins in same PDB: d1hm3a1, d1hm3a2
    complexed with ca, gcu, man, mxy, nag, ram, xys; mutant

Details for d1hm3a3

PDB Entry: 1hm3 (more details), 2.1 Å

PDB Description: active site of chondroitinase ac lyase revealed by the structure of enzyme-oligosaccharide complexes and mutagenesis

SCOP Domain Sequences for d1hm3a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hm3a3 b.30.5.2 (A:336-599) Chondroitinase AC {Pedobacter heparinus (Flavobacterium heparinum)}
iepyhhqfwngdyvqhlrpaysfnvrmvskrtrrsesgnkenllgrylsdgatniqlrgp
eyynimpvwewdkipgitsrdyltdrpltklwgeqgsndfaggvsdgvygasayaldyds
lqakkawfffdkeivclgaginsnapenitttlnqswlngpvistagktgrgkittfkaq
gqfwllhdaigyyfpeganlslstqsqkgnwfhinnshskdevsgdvfklwinhgarpen
aqyayivlpginkpeeikkyngta

SCOP Domain Coordinates for d1hm3a3:

Click to download the PDB-style file with coordinates for d1hm3a3.
(The format of our PDB-style files is described here.)

Timeline for d1hm3a3: