Lineage for d1hm3a2 (1hm3 A:600-699)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459627Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (1 superfamily)
    sandwich, 10 strands in 2 sheets; "folded meander"
  4. 459628Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (1 family) (S)
  5. 459629Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (4 proteins)
  6. 459633Protein Chondroitinase AC [49865] (2 species)
  7. 459641Species Pedobacter heparinus (Flavobacterium heparinum) [TaxId:984] [49866] (5 PDB entries)
  8. 459644Domain d1hm3a2: 1hm3 A:600-699 [61087]
    Other proteins in same PDB: d1hm3a1, d1hm3a3

Details for d1hm3a2

PDB Entry: 1hm3 (more details), 2.1 Å

PDB Description: active site of chondroitinase ac lyase revealed by the structure of enzyme-oligosaccharide complexes and mutagenesis

SCOP Domain Sequences for d1hm3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hm3a2 b.24.1.1 (A:600-699) Chondroitinase AC {Pedobacter heparinus (Flavobacterium heparinum)}
pkvlantnqlqavyhqqldmvqaifytagklsvagieietdkpcavlikhingkqviwaa
dplqkektavlsirdlktgktnrvkidfpqqefagatvel

SCOP Domain Coordinates for d1hm3a2:

Click to download the PDB-style file with coordinates for d1hm3a2.
(The format of our PDB-style files is described here.)

Timeline for d1hm3a2: