Lineage for d1hm3a1 (1hm3 A:26-335)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.102: alpha/alpha toroid [48207] (4 superfamilies) 
Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) 
Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (2 proteins) 
Protein Chondroitinase AC [48235] (1 species) Species Pedobacter heparinus (Flavobacterium heparinum) [TaxId:984] [48236] (5 PDB entries) 
Domain d1hm3a1: 1hm3 A:26-335 [61086]
Other proteins in same PDB: d1hm3a2, d1hm3a3
Details for d1hm3a1
PDB Entry: 1hm3 (more details), 2.1 Å
PDB Description: active site of chondroitinase ac lyase revealed by the structure of enzyme-oligosaccharide complexes and mutagenesis
SCOP Domain Sequences for d1hm3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hm3a1 a.102.3.2 (A:26-335) Chondroitinase AC {Pedobacter heparinus (Flavobacterium heparinum)}
gtaelimkrvmldlkkplrnmdkvaeknlntlqpdgswkdvpykddamtnwlpnnhllql
etiiqayiekdshyygddkvfdqiskafkywydsdpksrnwwhneiatpqalgemlilmr
ygkkpldealvhkltermkrgepekktganktdialhyfyralltsdeallsfavkelfy
pvqfvhyeeglqydysylqhgpqlqissygavfitgvlklanyvrdtpyalsteklaifs
kyyrdsylkairgsymdfnvegrgvsrpdilnkkaekkrllvakmidlkhteewadaiar
tdstvaagyk
SCOP Domain Coordinates for d1hm3a1:
Click to download the PDB-style file with coordinates for d1hm3a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hm3a1:
- d1hm3a1 first appeared in SCOP 1.57
- d1hm3a1 appears in SCOP 1.61
- d1hm3a1 appears in the current release, SCOPe 2.08
View in 3D
