Lineage for d1hm3a1 (1hm3 A:26-335)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 100027Fold a.102: alpha/alpha toroid [48207] (4 superfamilies)
  4. 100096Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) (S)
  5. 100102Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (2 proteins)
  6. 100103Protein Chondroitinase AC [48235] (1 species)
  7. 100104Species Pedobacter heparinus (Flavobacterium heparinum) [TaxId:984] [48236] (5 PDB entries)
  8. 100108Domain d1hm3a1: 1hm3 A:26-335 [61086]
    Other proteins in same PDB: d1hm3a2, d1hm3a3

Details for d1hm3a1

PDB Entry: 1hm3 (more details), 2.1 Å

PDB Description: active site of chondroitinase ac lyase revealed by the structure of enzyme-oligosaccharide complexes and mutagenesis

SCOP Domain Sequences for d1hm3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hm3a1 a.102.3.2 (A:26-335) Chondroitinase AC {Pedobacter heparinus (Flavobacterium heparinum)}
gtaelimkrvmldlkkplrnmdkvaeknlntlqpdgswkdvpykddamtnwlpnnhllql
etiiqayiekdshyygddkvfdqiskafkywydsdpksrnwwhneiatpqalgemlilmr
ygkkpldealvhkltermkrgepekktganktdialhyfyralltsdeallsfavkelfy
pvqfvhyeeglqydysylqhgpqlqissygavfitgvlklanyvrdtpyalsteklaifs
kyyrdsylkairgsymdfnvegrgvsrpdilnkkaekkrllvakmidlkhteewadaiar
tdstvaagyk

SCOP Domain Coordinates for d1hm3a1:

Click to download the PDB-style file with coordinates for d1hm3a1.
(The format of our PDB-style files is described here.)

Timeline for d1hm3a1: