Lineage for d1hm2a3 (1hm2 A:336-599)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58106Fold b.30: Supersandwich [49993] (4 superfamilies)
  4. 58194Superfamily b.30.3: Hyaluronate lyase-like, central domain [50005] (1 family) (S)
  5. 58195Family b.30.3.1: Hyaluronate lyase-like, central domain [50006] (2 protein domains)
  6. 58196Protein Chondroitinase AC [50007] (1 species)
  7. 58197Species Pedobacter heparinus (Flavobacterium heparinum) [TaxId:984] [50008] (5 PDB entries)
  8. 58200Domain d1hm2a3: 1hm2 A:336-599 [61085]
    Other proteins in same PDB: d1hm2a1, d1hm2a2

Details for d1hm2a3

PDB Entry: 1hm2 (more details), 2 Å

PDB Description: active site of chondroitinase ac lyase revealed by the structure of enzyme-oligosaccharide complexes and mutagenesis

SCOP Domain Sequences for d1hm2a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hm2a3 b.30.3.1 (A:336-599) Chondroitinase AC {Pedobacter heparinus (Flavobacterium heparinum)}
iepyhhqfwngdyvqhlrpaysfnvrmvskrtrrsesgnkenllgrylsdgatniqlrgp
eyynimpvwewdkipgitsrdyltdrpltklwgeqgsndfaggvsdgvygasayaldyds
lqakkawfffdkeivclgaginsnapenitttlnqswlngpvistagktgrgkittfkaq
gqfwllhdaigyyfpeganlslstqsqkgnwfhinnshskdevsgdvfklwinhgarpen
aqyayivlpginkpeeikkyngta

SCOP Domain Coordinates for d1hm2a3:

Click to download the PDB-style file with coordinates for d1hm2a3.
(The format of our PDB-style files is described here.)

Timeline for d1hm2a3: