Lineage for d1hm2a2 (1hm2 A:600-699)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 370953Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (1 superfamily)
    sandwich, 10 strands in 2 sheets; "folded meander"
  4. 370954Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (1 family) (S)
  5. 370955Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (4 proteins)
  6. 370959Protein Chondroitinase AC [49865] (2 species)
  7. 370967Species Pedobacter heparinus (Flavobacterium heparinum) [TaxId:984] [49866] (5 PDB entries)
  8. 370969Domain d1hm2a2: 1hm2 A:600-699 [61084]
    Other proteins in same PDB: d1hm2a1, d1hm2a3
    complexed with ca, gcu, idr, man, mxy, ngl, ram, xys; mutant

Details for d1hm2a2

PDB Entry: 1hm2 (more details), 2 Å

PDB Description: active site of chondroitinase ac lyase revealed by the structure of enzyme-oligosaccharide complexes and mutagenesis

SCOP Domain Sequences for d1hm2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hm2a2 b.24.1.1 (A:600-699) Chondroitinase AC {Pedobacter heparinus (Flavobacterium heparinum)}
pkvlantnqlqavyhqqldmvqaifytagklsvagieietdkpcavlikhingkqviwaa
dplqkektavlsirdlktgktnrvkidfpqqefagatvel

SCOP Domain Coordinates for d1hm2a2:

Click to download the PDB-style file with coordinates for d1hm2a2.
(The format of our PDB-style files is described here.)

Timeline for d1hm2a2: