Lineage for d1hm2a1 (1hm2 A:26-335)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722434Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) (S)
    incomplete toroid
  5. 2722452Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (5 proteins)
  6. 2722456Protein Chondroitinase AC [48235] (2 species)
    Chondroitin AC lyase
  7. 2722464Species Pedobacter heparinus (Flavobacterium heparinum) [TaxId:984] [48236] (5 PDB entries)
  8. 2722466Domain d1hm2a1: 1hm2 A:26-335 [61083]
    Other proteins in same PDB: d1hm2a2, d1hm2a3
    complexed with ca

Details for d1hm2a1

PDB Entry: 1hm2 (more details), 2 Å

PDB Description: active site of chondroitinase ac lyase revealed by the structure of enzyme-oligosaccharide complexes and mutagenesis
PDB Compounds: (A:) chondroitinase ac

SCOPe Domain Sequences for d1hm2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hm2a1 a.102.3.2 (A:26-335) Chondroitinase AC {Pedobacter heparinus (Flavobacterium heparinum) [TaxId: 984]}
gtaelimkrvmldlkkplrnmdkvaeknlntlqpdgswkdvpykddamtnwlpnnhllql
etiiqayiekdshyygddkvfdqiskafkywydsdpksrnwwhneiatpqalgemlilmr
ygkkpldealvhkltermkrgepekktganktdialhyfyralltsdeallsfavkelfy
pvqfvhyeeglqydysylqhgpqlqissygavfitgvlklanyvrdtpyalsteklaifs
kyyrdsylkairgsymdfnvegrgvsrpdilnkkaekkrllvakmidlkhteewadaiar
tdstvaagyk

SCOPe Domain Coordinates for d1hm2a1:

Click to download the PDB-style file with coordinates for d1hm2a1.
(The format of our PDB-style files is described here.)

Timeline for d1hm2a1: