SCOP 1.57: Domain d1hjca_: 1hjc A:

Lineage for d1hjca_ (1hjc A:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)

4. Superfamily b.2.5: p53-like transcription factors [49417] (1 family)

5. Family b.2.5.1: p53-like transcription factors [49418] (10 proteins)

6. Protein Acute myeloid leukemia 1 protein (AML1), RUNT domain [49439] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [63684] (3 PDB entries)

8. Domain d1hjca_: 1hjc A: [61079]

Details for d1hjca_

PDB Entry: 1hjc, 2.65 Å

PDB Description: crystal structure of runx-1/aml1/cbfalpha runt domain bound to a dna fragment from the csf-1r promoter

SCOP Domain Sequences for d1hjca_:

Sequence; same for both SEQRES and ATOM records:

>d1hjca_ b.2.5.1 (A:) Acute myeloid leukemia 1 protein (AML1), RUNT domain {Mouse (Mus musculus)}
gelvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagndenysaelrn
ataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvdgprepr

Timeline for d1hjca_:

• d1hjca_ is new in SCOP 1.57
  
• d1hjca_ appears in SCOP 1.59
  
• d1hjca_ appears in the current release, SCOPe 2.08