Lineage for d1hjbc_ (1hjb C:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 368237Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 368422Superfamily b.2.5: p53-like transcription factors [49417] (6 families) (S)
  5. 368527Family b.2.5.6: RUNT domain [81318] (1 protein)
  6. 368528Protein Acute myeloid leukemia 1 protein (AML1), RUNT domain [49439] (2 species)
    synonym: core binding factor alpha, cbfa
  7. 368542Species Mouse (Mus musculus) [TaxId:10090] [63684] (6 PDB entries)
    almost identical sequence to the human protein
  8. 368550Domain d1hjbc_: 1hjb C: [61075]
    Other proteins in same PDB: d1hjba_, d1hjbb_, d1hjbd_, d1hjbe_

Details for d1hjbc_

PDB Entry: 1hjb (more details), 3 Å

PDB Description: crystal structure of runx-1/aml1/cbfalpha runt domain and c/ebpbeta bzip homodimer bound to a dna fragment from the csf-1r promoter

SCOP Domain Sequences for d1hjbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hjbc_ b.2.5.6 (C:) Acute myeloid leukemia 1 protein (AML1), RUNT domain {Mouse (Mus musculus)}
gelvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagndenysaelrn
ataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvdgpreprrh

SCOP Domain Coordinates for d1hjbc_:

Click to download the PDB-style file with coordinates for d1hjbc_.
(The format of our PDB-style files is described here.)

Timeline for d1hjbc_: