SCOP 1.71: Domain d1hj7a2: 1hj7 A:334-372

Lineage for d1hj7a2 (1hj7 A:334-372)

1. Root: SCOP 1.71

2. Class g: Small proteins [56992] (79 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (6 families)

5. Family g.3.11.1: EGF-type module [57197] (22 proteins)

6. Protein Low density lipoprotein (LDL) receptor, different EGF domains [64539] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64540] (6 PDB entries)

8. Domain d1hj7a2: 1hj7 A:334-372 [61072]
   complexed with ca

Details for d1hj7a2

PDB Entry: 1hj7

PDB Description: nmr study of a pair of ldl receptor ca2+ binding epidermal growth factor-like domains, 20 structures

SCOP Domain Sequences for d1hj7a2:

Sequence; same for both SEQRES and ATOM records:

>d1hj7a2 g.3.11.1 (A:334-372) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens)}
idecqdpdtcsqlcvnleggykcqceegfqldphtkack

Timeline for d1hj7a2:

• d1hj7a2 first appeared in SCOP 1.57
  
• d1hj7a2 appears in SCOP 1.69
  
• d1hj7a2 appears in SCOP 1.73
  
• d1hj7a2 appears in the current release, SCOPe 2.08