Lineage for d1hj7a2 (1hj7 A:334-372)
- Root: SCOP 1.57
Class g: Small proteins [56992] (56 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies) 
Superfamily g.3.11: EGF/Laminin [57196] (5 families) 
Family g.3.11.1: EGF-type module [57197] (17 proteins) 
Protein Low density lipoprotein (LDL) receptor, different EGF domains [64539] (1 species) Species Human (Homo sapiens) [TaxId:9606] [64540] (4 PDB entries) 
Domain d1hj7a2: 1hj7 A:334-372 [61072]
Details for d1hj7a2
PDB Entry: 1hj7 (more details)
PDB Description: nmr study of a pair of ldl receptor ca2+ binding epidermal growth factor-like domains, 20 structures
SCOP Domain Sequences for d1hj7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hj7a2 g.3.11.1 (A:334-372) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens)}
idecqdpdtcsqlcvnleggykcqceegfqldphtkack
SCOP Domain Coordinates for d1hj7a2:
Click to download the PDB-style file with coordinates for d1hj7a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hj7a2:
- d1hj7a2 is new in SCOP 1.57
- d1hj7a2 appears in SCOP 1.59
- d1hj7a2 appears in the current release, SCOPe 2.08
View in 3D
