SCOPe 2.05: Domain d1hi9d_: 1hi9 D:

Lineage for d1hi9d_ (1hi9 D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.99: Dipeptide transport protein [63991] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; also contains a C-terminal alpha+beta subdomain

4. Superfamily c.99.1: Dipeptide transport protein [63992] (1 family)
   automatically mapped to Pfam PF04951

5. Family c.99.1.1: Dipeptide transport protein [63993] (1 protein)

6. Protein Zn-dependent D-aminopeptidase DppA [63994] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [63995] (1 PDB entry)

8. Domain d1hi9d_: 1hi9 D: [61066]
   complexed with zn

Details for d1hi9d_

PDB Entry: 1hi9, 2.4 Å

PDB Description: zn-dependent d-aminopeptidase dppa from bacillus subtilis, a self- compartmentalizing protease.

PDB Compounds: (D:) dipeptide transport protein dppa

SCOPe Domain Sequences for d1hi9d_:

Sequence; same for both SEQRES and ATOM records:

>d1hi9d_ c.99.1.1 (D:) Zn-dependent D-aminopeptidase DppA {Bacillus subtilis [TaxId: 1423]}
mklymsvdmegisglpddtfvdsgkrnyergrlimteeanyciaeafnsgctevlvndsh
skmnnlmveklhpeadlisgdvkpfsmveglddtfrgalflgyharastpgvmshsmifg
vrhfyindrpvgelglnayvagyydvpvlmvagddraakeaeelipnvttaavkqtisrs
avkclspakrgrlltektafalqnkdkvkpltppdrpvlsiefanygqaewanlmpgtei
ktgtttvqfqakdmleayqamlvmtelamrtsfc

Timeline for d1hi9d_:

• d1hi9d_ first appeared in SCOP 1.57
  
• d1hi9d_ appears in SCOPe 2.04
  
• d1hi9d_ appears in SCOPe 2.06
  
• d1hi9d_ appears in the current release, SCOPe 2.08