Lineage for d1hi9d_ (1hi9 D:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 75741Fold c.99: Dipeptide transport protein [63991] (1 superfamily)
  4. 75742Superfamily c.99.1: Dipeptide transport protein [63992] (1 family) (S)
  5. 75743Family c.99.1.1: Dipeptide transport protein [63993] (1 protein)
  6. 75744Protein Zn-dependent D-aminopeptidase DppA [63994] (1 species)
  7. 75745Species Bacillus subtilis [TaxId:1423] [63995] (1 PDB entry)
  8. 75749Domain d1hi9d_: 1hi9 D: [61066]

Details for d1hi9d_

PDB Entry: 1hi9 (more details), 2.4 Å

PDB Description: zn-dependent d-aminopeptidase dppa from bacillus subtilis, a self- compartmentalizing protease.

SCOP Domain Sequences for d1hi9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hi9d_ c.99.1.1 (D:) Zn-dependent D-aminopeptidase DppA {Bacillus subtilis}
mklymsvdmegisglpddtfvdsgkrnyergrlimteeanyciaeafnsgctevlvndsh
skmnnlmveklhpeadlisgdvkpfsmveglddtfrgalflgyharastpgvmshsmifg
vrhfyindrpvgelglnayvagyydvpvlmvagddraakeaeelipnvttaavkqtisrs
avkclspakrgrlltektafalqnkdkvkpltppdrpvlsiefanygqaewanlmpgtei
ktgtttvqfqakdmleayqamlvmtelamrtsfc

SCOP Domain Coordinates for d1hi9d_:

Click to download the PDB-style file with coordinates for d1hi9d_.
(The format of our PDB-style files is described here.)

Timeline for d1hi9d_: