SCOPe 2.05: Domain d1hi5a_: 1hi5 A:

Lineage for d1hi5a_ (1hi5 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Eosinophil-derived neurotoxin (EDN) [64205] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64206] (11 PDB entries)

8. Domain d1hi5a_: 1hi5 A: [61060]
   protein/RNA complex; complexed with adp

Details for d1hi5a_

PDB Entry: 1hi5, 1.8 Å

PDB Description: eosinophil-derived neurotoxin (edn) - adenosine-5'-diphosphate complex

PDB Compounds: (A:) eosinophil-derived neurotoxin

SCOPe Domain Sequences for d1hi5a_:

Sequence; same for both SEQRES and ATOM records:

>d1hi5a_ d.5.1.1 (A:) Eosinophil-derived neurotoxin (EDN) {Human (Homo sapiens) [TaxId: 9606]}
mkppqftwaqwfetqhinmtsqqctnamqvinnyqrrcknqntfllttfanvvnvcgnpn
mtcpsnktrknchhsgsqvplihcnlttpspqnisncryaqtpanmfyivacdnrdqrrd
ppqypvvpvhldrii

Timeline for d1hi5a_:

• d1hi5a_ first appeared in SCOP 1.57
  
• d1hi5a_ appears in SCOPe 2.04
  
• d1hi5a_ is called d1hi5a1 in SCOPe 2.06
  
• d1hi5a_ appears in the current release, SCOPe 2.08, called d1hi5a1