Lineage for d1hi5a_ (1hi5 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1890050Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1890051Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1890052Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1890136Protein Eosinophil-derived neurotoxin (EDN) [64205] (1 species)
  7. 1890137Species Human (Homo sapiens) [TaxId:9606] [64206] (11 PDB entries)
  8. 1890144Domain d1hi5a_: 1hi5 A: [61060]
    protein/RNA complex; complexed with adp

Details for d1hi5a_

PDB Entry: 1hi5 (more details), 1.8 Å

PDB Description: eosinophil-derived neurotoxin (edn) - adenosine-5'-diphosphate complex
PDB Compounds: (A:) eosinophil-derived neurotoxin

SCOPe Domain Sequences for d1hi5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hi5a_ d.5.1.1 (A:) Eosinophil-derived neurotoxin (EDN) {Human (Homo sapiens) [TaxId: 9606]}
mkppqftwaqwfetqhinmtsqqctnamqvinnyqrrcknqntfllttfanvvnvcgnpn
mtcpsnktrknchhsgsqvplihcnlttpspqnisncryaqtpanmfyivacdnrdqrrd
ppqypvvpvhldrii

SCOPe Domain Coordinates for d1hi5a_:

Click to download the PDB-style file with coordinates for d1hi5a_.
(The format of our PDB-style files is described here.)

Timeline for d1hi5a_: