Lineage for d1hi5a_ (1hi5 A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77162Fold d.5: RNase A-like [54075] (1 superfamily)
  4. 77163Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
  5. 77164Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 77189Protein Eosinophil-derived neurotoxin (EDN) [64205] (1 species)
  7. 77190Species Human (Homo sapiens) [TaxId:9606] [64206] (4 PDB entries)
  8. 77193Domain d1hi5a_: 1hi5 A: [61060]

Details for d1hi5a_

PDB Entry: 1hi5 (more details), 1.8 Å

PDB Description: eosinophil-derived neurotoxin (edn) - adenosine-5'-diphosphate complex

SCOP Domain Sequences for d1hi5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hi5a_ d.5.1.1 (A:) Eosinophil-derived neurotoxin (EDN) {Human (Homo sapiens)}
mkppqftwaqwfetqhinmtsqqctnamqvinnyqrrcknqntfllttfanvvnvcgnpn
mtcpsnktrknchhsgsqvplihcnlttpspqnisncryaqtpanmfyivacdnrdqrrd
ppqypvvpvhldrii

SCOP Domain Coordinates for d1hi5a_:

Click to download the PDB-style file with coordinates for d1hi5a_.
(The format of our PDB-style files is described here.)

Timeline for d1hi5a_: