Lineage for d1hi3a_ (1hi3 A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 253232Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 253233Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
    can be classified as disulphide-rich
  5. 253234Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 253273Protein Eosinophil-derived neurotoxin (EDN) [64205] (1 species)
  7. 253274Species Human (Homo sapiens) [TaxId:9606] [64206] (6 PDB entries)
  8. 253278Domain d1hi3a_: 1hi3 A: [61058]
    complexed with a2p

Details for d1hi3a_

PDB Entry: 1hi3 (more details), 1.8 Å

PDB Description: eosinophil-derived neurotoxin (edn) - adenosine 2'-5'-diphosphate complex

SCOP Domain Sequences for d1hi3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hi3a_ d.5.1.1 (A:) Eosinophil-derived neurotoxin (EDN) {Human (Homo sapiens)}
mkppqftwaqwfetqhinmtsqqctnamqvinnyqrrcknqntfllttfanvvnvcgnpn
mtcpsnktrknchhsgsqvplihcnlttpspqnisncryaqtpanmfyivacdnrdqrrd
ppqypvvpvhldrii

SCOP Domain Coordinates for d1hi3a_:

Click to download the PDB-style file with coordinates for d1hi3a_.
(The format of our PDB-style files is described here.)

Timeline for d1hi3a_: