Lineage for d1hi1c_ (1hi1 C:)

  1. Root: SCOP 1.59
  2. 140364Class e: Multi-domain proteins (alpha and beta) [56572] (34 folds)
  3. 140913Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
  4. 140914Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
  5. 141142Family e.8.1.6: dsRNA phage RNA-dependent RNA-polymerase [64480] (1 protein)
  6. 141143Protein dsRNA phage RNA-dependent RNA-polymerase [64481] (1 species)
  7. 141144Species Bacteriophage PHI-6 [TaxId:10879] [64482] (5 PDB entries)
  8. 141158Domain d1hi1c_: 1hi1 C: [61056]

Details for d1hi1c_

PDB Entry: 1hi1 (more details), 3 Å

PDB Description: rna dependent rna polymerase from dsrna bacteriophage phi6 plus bound ntp

SCOP Domain Sequences for d1hi1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hi1c_ e.8.1.6 (C:) dsRNA phage RNA-dependent RNA-polymerase {Bacteriophage PHI-6}
prrapafplsdikaqmlfannikaqqaskrsfkegaietyegllsvdprflsfknelsry
ltdhfpanvdeygrvygngvrtnffgmrhmngfpmipatwplasnlkkradadladgpvs
erdnllfraavrlmfsdlepvplkirkgsstcipyfsndmgtkieiaeralekaeeagnl
mlqgkfddayqlhqmggayyvvyraqstdaitldpktgkfvskdrmvadfeyavtggeqg
slfaaskdasrlkeqygidvpdgffcerrrtamggpfalnapimavaqpvrnkiyskyay
tfhhttrlnkeekvkewslcvatdvsdhdtfwpgwlrdlicdellnmgyapwwvklfets
lklpvyvgapapeqghtllgdpsnpdlevglssgqgatdlmgtllmsitylvmqldhtap
hlnsrikdmpsacrfldsywqgheeirqisksddamlgwtkgralvgghrlfemlkegkv
npspymkisyehggaflgdillydsrrepgsaifvgninsmlnnqfspeygvqsgvrdrs
krkrpfpglawasmkdtygacpiysdvleaiercwwnafgesyrayredmlkrdtlelsr
yvasmarqaglaeltpidlevladpnklqykwteadvsanihevlmhgvsvekterflrs
vmpr

SCOP Domain Coordinates for d1hi1c_:

Click to download the PDB-style file with coordinates for d1hi1c_.
(The format of our PDB-style files is described here.)

Timeline for d1hi1c_: