Lineage for d1hhtq_ (1hht Q:)

  1. Root: SCOP 1.69
  2. 517079Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)
  3. 517941Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 517942Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 518314Family e.8.1.6: dsRNA phage RNA-dependent RNA-polymerase [64480] (1 protein)
  6. 518315Protein dsRNA phage RNA-dependent RNA-polymerase [64481] (1 species)
  7. 518316Species Bacteriophage PHI-6 [TaxId:10879] [64482] (11 PDB entries)
  8. 518347Domain d1hhtq_: 1hht Q: [61049]

Details for d1hhtq_

PDB Entry: 1hht (more details), 2.9 Å

PDB Description: rna dependent rna polymerase from dsrna bacteriophage phi6 plus template

SCOP Domain Sequences for d1hhtq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hhtq_ e.8.1.6 (Q:) dsRNA phage RNA-dependent RNA-polymerase {Bacteriophage PHI-6}
prrapafplsdikaqmlfannikaqqaskrsfkegaietyegllsvdprflsfknelsry
ltdhfpanvdeygrvygngvrtnffgmrhmngfpmipatwplasnlkkradadladgpvs
erdnllfraavrlmfsdlepvplkirkgsstcipyfsndmgtkieiaeralekaeeagnl
mlqgkfddayqlhqmggayyvvyraqstdaitldpktgkfvskdrmvadfeyavtggeqg
slfaaskdasrlkeqygidvpdgffcerrrtamggpfalnapimavaqpvrnkiyskyay
tfhhttrlnkeekvkewslcvatdvsdhdtfwpgwlrdlicdellnmgyapwwvklfets
lklpvyvgapapeqghtllgdpsnpdlevglssgqgatdlmgtllmsitylvmqldhtap
hlnsrikdmpsacrfldsywqgheeirqisksddamlgwtkgralvgghrlfemlkegkv
npspymkisyehggaflgdillydsrrepgsaifvgninsmlnnqfspeygvqsgvrdrs
krkrpfpglawasmkdtygacpiysdvleaiercwwnafgesyrayredmlkrdtlelsr
yvasmarqaglaeltpidlevladpnklqykwteadvsanihevlmhgvsvekterflrs
vmpr

SCOP Domain Coordinates for d1hhtq_:

Click to download the PDB-style file with coordinates for d1hhtq_.
(The format of our PDB-style files is described here.)

Timeline for d1hhtq_: