Lineage for d1hhsb_ (1hhs B:)

  1. Root: SCOP 1.57
  2. 86313Class e: Multi-domain proteins (alpha and beta) [56572] (32 folds)
  3. 86813Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
  4. 86814Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
  5. 87013Family e.8.1.6: dsRNA phage RNA-dependent RNA-polymerase [64480] (1 protein)
  6. 87014Protein dsRNA phage RNA-dependent RNA-polymerase [64481] (1 species)
  7. 87015Species Bacteriophage PHI-6 [TaxId:10879] [64482] (5 PDB entries)
  8. 87017Domain d1hhsb_: 1hhs B: [61046]

Details for d1hhsb_

PDB Entry: 1hhs (more details), 2 Å

PDB Description: rna dependent rna polymerase from dsrna bacteriophage phi6

SCOP Domain Sequences for d1hhsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hhsb_ e.8.1.6 (B:) dsRNA phage RNA-dependent RNA-polymerase {Bacteriophage PHI-6}
prrapafplsdikaqmlfannikaqqaskrsfkegaietyegllsvdprflsfknelsry
ltdhfpanvdeygrvygngvrtnffgmrhmngfpmipatwplasnlkkradadladgpvs
erdnllfraavrlmfsdlepvplkirkgsstcipyfsndmgtkieiaeralekaeeagnl
mlqgkfddayqlhqmggayyvvyraqstdaitldpktgkfvskdrmvadfeyavtggeqg
slfaaskdasrlkeqygidvpdgffcerrrtamggpfalnapimavaqpvrnkiyskyay
tfhhttrlnkeekvkewslcvatdvsdhdtfwpgwlrdlicdellnmgyapwwvklfets
lklpvyvgapapeqghtllgdpsnpdlevglssgqgatdlmgtllmsitylvmqldhtap
hlnsrikdmpsacrfldsywqgheeirqisksddamlgwtkgralvgghrlfemlkegkv
npspymkisyehggaflgdillydsrrepgsaifvgninsmlnnqfspeygvqsgvrdrs
krkrpfpglawasmkdtygacpiysdvleaiercwwnafgesyrayredmlkrdtlelsr
yvasmarqaglaeltpidlevladpnklqykwteadvsanihevlmhgvsvekterflrs
vmpr

SCOP Domain Coordinates for d1hhsb_:

Click to download the PDB-style file with coordinates for d1hhsb_.
(The format of our PDB-style files is described here.)

Timeline for d1hhsb_: