Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
Protein Nucleoside diphosphate kinase, NDK [54921] (21 species) |
Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [54925] (21 PDB entries) |
Domain d1hhqa_: 1hhq A: [61044] complexed with so4 |
PDB Entry: 1hhq (more details), 2.1 Å
SCOPe Domain Sequences for d1hhqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hhqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} vnkertflavapdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd svesanreialwfkpeelltevkpnpnlye
Timeline for d1hhqa_: