Lineage for d1hhna1 (1hhn A:189-288)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2085782Fold b.104: P-domain of calnexin/calreticulin [63886] (1 superfamily)
    non-globular proline-rich hairpin
  4. 2085783Superfamily b.104.1: P-domain of calnexin/calreticulin [63887] (1 family) (S)
  5. 2085784Family b.104.1.1: P-domain of calnexin/calreticulin [63888] (2 proteins)
  6. 2085788Protein Calreticulin [63889] (1 species)
  7. 2085789Species Norway rat (Rattus norvegicus) [TaxId:10116] [63890] (3 PDB entries)
  8. 2085792Domain d1hhna1: 1hhn A:189-288 [61043]
    Other proteins in same PDB: d1hhna2

Details for d1hhna1

PDB Entry: 1hhn (more details)

PDB Description: calreticulin p-domain
PDB Compounds: (A:) calreticulin

SCOPe Domain Sequences for d1hhna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hhna1 b.104.1.1 (A:189-288) Calreticulin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kkikdpdaakpedwderakiddptdskpedwdkpehipdpdakkpedwdeemdgeweppv
iqnpeykgewkprqidnpdykgtwihpeidnpeyspdani

SCOPe Domain Coordinates for d1hhna1:

Click to download the PDB-style file with coordinates for d1hhna1.
(The format of our PDB-style files is described here.)

Timeline for d1hhna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hhna2