SCOP 1.63: Domain d1hh8a_: 1hh8 A:

Lineage for d1hh8a_ (1hh8 A:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (17 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (2 families)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (8 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein Neutrophil cytosolic factor 2 (NCF-2, p67-phox) [48460] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48461] (2 PDB entries)

8. Domain d1hh8a_: 1hh8 A: [61042]
   complexed with flc; mutant

Details for d1hh8a_

PDB Entry: 1hh8, 1.8 Å

PDB Description: the active n-terminal region of p67phox: structure at 1.8 angstrom resolution and biochemical characterizations of the a128v mutant implicated in chronic granulomatous disease

SCOP Domain Sequences for d1hh8a_:

Sequence; same for both SEQRES and ATOM records:

>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens)}
slveaislwnegvlaadkkdwkgaldafsavqdphsricfnigcmytilknmteaekaft
rsinrdkhlavayfqrgmlyyqtekydlaikdlkealiqlrgnqlidykilglqfklfac
evlyniafmyakkeewkkaeeqlalatsmkseprhskidkamecvwkqklyepvvipvgr
lfrpnerqvaql

Timeline for d1hh8a_:

• d1hh8a_ first appeared in SCOP 1.57
  
• d1hh8a_ appears in SCOP 1.61
  
• d1hh8a_ appears in SCOP 1.65
  
• d1hh8a_ appears in the current release, SCOPe 2.08