![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.8: TPR-like [48452] (11 families) ![]() |
![]() | Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
![]() | Protein Neutrophil cytosolic factor 2 (NCF-2, p67-phox) [48460] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48461] (2 PDB entries) |
![]() | Domain d1hh8a_: 1hh8 A: [61042] complexed with flc; mutant has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1hh8 (more details), 1.8 Å
SCOPe Domain Sequences for d1hh8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} slveaislwnegvlaadkkdwkgaldafsavqdphsricfnigcmytilknmteaekaft rsinrdkhlavayfqrgmlyyqtekydlaikdlkealiqlrgnqlidykilglqfklfac evlyniafmyakkeewkkaeeqlalatsmkseprhskidkamecvwkqklyepvvipvgr lfrpnerqvaql
Timeline for d1hh8a_: