SCOP 1.69: Domain d1hh4e_: 1hh4 E:

Lineage for d1hh4e_ (1hh4 E:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.8: RhoGDI-like [81288] (2 proteins)

6. Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49242] (9 PDB entries)

8. Domain d1hh4e_: 1hh4 E: [61040]
   Other proteins in same PDB: d1hh4a_, d1hh4b_
   complex with rac1

Details for d1hh4e_

PDB Entry: 1hh4, 2.7 Å

PDB Description: rac1-rhogdi complex involved in nadph oxidase activation

SCOP Domain Sequences for d1hh4e_:

Sequence; same for both SEQRES and ATOM records:

>d1hh4e_ b.1.18.8 (E:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens)}
hsvnykppaqksiqeiqeldkddeslrkykeallgrvavsadpnvpnvvvtgltlvcssa
pgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgmkyiqhtyrkgvkidkt
dymvgsygpraeeyefltpveeapkgmlargsysiksrftdddktdhlswewnltikkdw

Timeline for d1hh4e_:

• d1hh4e_ first appeared in SCOP 1.57
  
• d1hh4e_ appears in SCOP 1.67
  
• d1hh4e_ appears in SCOP 1.71
  
• d1hh4e_ appears in the current release, SCOPe 2.08