Lineage for d1hh4e_ (1hh4 E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765599Family b.1.18.8: RhoGDI-like [81288] (3 proteins)
  6. 2765633Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species)
  7. 2765638Species Human (Homo sapiens) [TaxId:9606] [49242] (12 PDB entries)
  8. 2765665Domain d1hh4e_: 1hh4 E: [61040]
    Other proteins in same PDB: d1hh4a1, d1hh4a2, d1hh4b1, d1hh4b2
    complex with rac1
    complexed with gdp, ger, mg

Details for d1hh4e_

PDB Entry: 1hh4 (more details), 2.7 Å

PDB Description: rac1-rhogdi complex involved in nadph oxidase activation
PDB Compounds: (E:) rho GDP-dissociation inhibitor 1

SCOPe Domain Sequences for d1hh4e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hh4e_ b.1.18.8 (E:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]}
hsvnykppaqksiqeiqeldkddeslrkykeallgrvavsadpnvpnvvvtgltlvcssa
pgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgmkyiqhtyrkgvkidkt
dymvgsygpraeeyefltpveeapkgmlargsysiksrftdddktdhlswewnltikkdw

SCOPe Domain Coordinates for d1hh4e_:

Click to download the PDB-style file with coordinates for d1hh4e_.
(The format of our PDB-style files is described here.)

Timeline for d1hh4e_: