Lineage for d1hh4d_ (1hh4 D:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 551984Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 552337Family b.1.18.8: RhoGDI-like [81288] (2 proteins)
  6. 552343Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (2 species)
  7. 552352Species Human (Homo sapiens) [TaxId:9606] [49242] (9 PDB entries)
  8. 552366Domain d1hh4d_: 1hh4 D: [61039]
    Other proteins in same PDB: d1hh4a_, d1hh4b_

Details for d1hh4d_

PDB Entry: 1hh4 (more details), 2.7 Å

PDB Description: rac1-rhogdi complex involved in nadph oxidase activation

SCOP Domain Sequences for d1hh4d_:

Sequence, based on SEQRES records: (download)

>d1hh4d_ b.1.18.8 (D:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens)}
eqlaqiaaeneedehsvnykppaqksiqeiqeldkddeslrkykeallgrvavsadpnvp
nvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgmky
iqhtyrkgvkidktdymvgsygpraeeyefltpveeapkgmlargsysiksrftdddktd
hlswewnltikkd

Sequence, based on observed residues (ATOM records): (download)

>d1hh4d_ b.1.18.8 (D:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens)}
eqlaqiaaeneedehsvnykppaqksiqeiqeldkddeslrkykeallgrnvpnvvvtgl
tlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgmkyiqhtyrk
gvkidktdymvgsygpraeeyefltpveeapkgmlargsysiksrftdddktdhlswewn
ltikkd

SCOP Domain Coordinates for d1hh4d_:

Click to download the PDB-style file with coordinates for d1hh4d_.
(The format of our PDB-style files is described here.)

Timeline for d1hh4d_: