SCOP 1.65: Domain d1hh4b_: 1hh4 B:

Lineage for d1hh4b_ (1hh4 B:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (35 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rac [52595] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52596] (10 PDB entries)

8. Domain d1hh4b_: 1hh4 B: [61038]
   Other proteins in same PDB: d1hh4d_, d1hh4e_
   rac1 in complex with RhoGD
   complexed with gdp, ger, mg

Details for d1hh4b_

PDB Entry: 1hh4, 2.7 Å

PDB Description: rac1-rhogdi complex involved in nadph oxidase activation

SCOP Domain Sequences for d1hh4b_:

Sequence; same for both SEQRES and ATOM records:

>d1hh4b_ c.37.1.8 (B:) Rac {Human (Homo sapiens)}
pqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
qedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlcpp
pvkkrkrkc

Timeline for d1hh4b_:

• d1hh4b_ first appeared in SCOP 1.57
  
• d1hh4b_ appears in SCOP 1.63
  
• d1hh4b_ appears in SCOP 1.67
  
• d1hh4b_ appears in the current release, SCOPe 2.08, called d1hh4b1