Lineage for d1hh4b_ (1hh4 B:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) 
Family c.37.1.8: G proteins [52592] (26 proteins) 
Protein Rac [52595] (1 species) Species Human (Homo sapiens) [TaxId:9606] [52596] (10 PDB entries) 
Domain d1hh4b_: 1hh4 B: [61038]
Other proteins in same PDB: d1hh4d_, d1hh4e_
Details for d1hh4b_
PDB Entry: 1hh4 (more details), 2.7 Å
PDB Description: rac1-rhogdi complex involved in nadph oxidase activation
SCOP Domain Sequences for d1hh4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hh4b_ c.37.1.8 (B:) Rac {Human (Homo sapiens)}
pqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
qedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlcpp
pvkkrkrkc
SCOP Domain Coordinates for d1hh4b_:
Click to download the PDB-style file with coordinates for d1hh4b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hh4b_:
- d1hh4b_ first appeared in SCOP 1.57
- d1hh4b_ appears in SCOP 1.59
- d1hh4b_ appears in SCOP 1.63
- d1hh4b_ appears in the current release, SCOPe 2.08, called d1hh4b1
View in 3D
