Lineage for d1hh4a_ (1hh4 A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 581859Family c.37.1.8: G proteins [52592] (45 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 582214Protein Rac [52595] (1 species)
  7. 582215Species Human (Homo sapiens) [TaxId:9606] [52596] (12 PDB entries)
  8. 582232Domain d1hh4a_: 1hh4 A: [61037]
    Other proteins in same PDB: d1hh4d_, d1hh4e_

Details for d1hh4a_

PDB Entry: 1hh4 (more details), 2.7 Å

PDB Description: rac1-rhogdi complex involved in nadph oxidase activation

SCOP Domain Sequences for d1hh4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hh4a_ c.37.1.8 (A:) Rac {Human (Homo sapiens)}
pqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
qedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlcpp
pvkkrkrkc

SCOP Domain Coordinates for d1hh4a_:

Click to download the PDB-style file with coordinates for d1hh4a_.
(The format of our PDB-style files is described here.)

Timeline for d1hh4a_: