SCOP 1.59: Domain d1hh4a_: 1hh4 A:

Lineage for d1hh4a_ (1hh4 A:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families)

5. Family c.37.1.8: G proteins [52592] (23 proteins)

6. Protein Rac [52595] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52596] (10 PDB entries)

8. Domain d1hh4a_: 1hh4 A: [61037]
   Other proteins in same PDB: d1hh4d_, d1hh4e_

Details for d1hh4a_

PDB Entry: 1hh4, 2.7 Å

PDB Description: rac1-rhogdi complex involved in nadph oxidase activation

SCOP Domain Sequences for d1hh4a_:

Sequence; same for both SEQRES and ATOM records:

>d1hh4a_ c.37.1.8 (A:) Rac {Human (Homo sapiens)}
pqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
qedydrlrplsypqtdvslicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlcpp
pvkkrkrkc

Timeline for d1hh4a_:

• d1hh4a_ first appeared in SCOP 1.57
  
• d1hh4a_ appears in SCOP 1.61
  
• d1hh4a_ appears in the current release, SCOPe 2.08, called d1hh4a1