SCOPe 2.06: Domain d1hgva_: 1hgv A:

Lineage for d1hgva_ (1hgv A:)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.4: Inovirus (filamentous phage) major coat protein [57987] (1 family)

5. Family h.1.4.1: Inovirus (filamentous phage) major coat protein [57988] (1 protein)

6. Protein Inovirus (filamentous phage) major coat protein [57989] (8 species)

7. Species Bacteriophage ph75, Inovirus ph75 [TaxId:144736] [64591] (3 PDB entries)

8. Domain d1hgva_: 1hgv A: [61033]

Details for d1hgva_

PDB Entry: 1hgv, 2.4 Å

PDB Description: filamentous bacteriophage ph75

PDB Compounds: (A:) ph75 inovirus major coat protein

SCOPe Domain Sequences for d1hgva_:

Sequence; same for both SEQRES and ATOM records:

>d1hgva_ h.1.4.1 (A:) Inovirus (filamentous phage) major coat protein {Bacteriophage ph75, Inovirus ph75 [TaxId: 144736]}
mdfnpsevasqvtnyiqaiaaagvgvlalaiglsaawkyakrflkg

Timeline for d1hgva_:

• d1hgva_ first appeared in SCOP 1.57
  
• d1hgva_ appears in SCOPe 2.05
  
• d1hgva_ appears in SCOPe 2.07
  
• d1hgva_ appears in the current release, SCOPe 2.08