Lineage for d1hg3g_ (1hg3 G:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1143365Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 1143366Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
  6. 1143367Protein Triosephosphate isomerase [51353] (21 species)
  7. 1143504Species Pyrococcus woesei [TaxId:2262] [63891] (1 PDB entry)
  8. 1143511Domain d1hg3g_: 1hg3 G: [61031]
    complexed with 3pp

Details for d1hg3g_

PDB Entry: 1hg3 (more details), 2.7 Å

PDB Description: crystal structure of tetrameric tim from pyrococcus woesei.
PDB Compounds: (G:) triosephosphate isomerase

SCOPe Domain Sequences for d1hg3g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hg3g_ c.1.1.1 (G:) Triosephosphate isomerase {Pyrococcus woesei [TaxId: 2262]}
aklkepiiainfktyieatgkraleiakaaekvyketgvtivvapqlvdlrmiaesveip
vfaqhidpikpgshtghvlpeavkeagavgtllnhsenrmiladleaairraeevglmtm
vcsnnpavsaavaalnpdyvaveppeligtgipvskakpevitntvelvkkvnpevkvlc
gagistgedvkkaielgtvgvllasgvtkakdpekaiwdlvsgi

SCOPe Domain Coordinates for d1hg3g_:

Click to download the PDB-style file with coordinates for d1hg3g_.
(The format of our PDB-style files is described here.)

Timeline for d1hg3g_: