Lineage for d1hg3f_ (1hg3 F:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64293Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 64294Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 64295Protein Triosephosphate isomerase [51353] (13 species)
  7. 64296Species Archaeon Pyrococcus woesei [TaxId:2262] [63891] (1 PDB entry)
  8. 64302Domain d1hg3f_: 1hg3 F: [61030]

Details for d1hg3f_

PDB Entry: 1hg3 (more details), 2.7 Å

PDB Description: crystal structure of tetrameric tim from pyrococcus woesei.

SCOP Domain Sequences for d1hg3f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hg3f_ c.1.1.1 (F:) Triosephosphate isomerase {Archaeon Pyrococcus woesei}
aklkepiiainfktyieatgkraleiakaaekvyketgvtivvapqlvdlrmiaesveip
vfaqhidpikpgshtghvlpeavkeagavgtllnhsenrmiladleaairraeevglmtm
vcsnnpavsaavaalnpdyvaveppeligtgipvskakpevitntvelvkkvnpevkvlc
gagistgedvkkaielgtvgvllasgvtkakdpekaiwdlvsgi

SCOP Domain Coordinates for d1hg3f_:

Click to download the PDB-style file with coordinates for d1hg3f_.
(The format of our PDB-style files is described here.)

Timeline for d1hg3f_: