Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) |
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein) |
Protein Triosephosphate isomerase [51353] (20 species) |
Species Pyrococcus woesei [TaxId:2262] [63891] (1 PDB entry) |
Domain d1hg3c_: 1hg3 C: [61027] complexed with 3pp |
PDB Entry: 1hg3 (more details), 2.7 Å
SCOPe Domain Sequences for d1hg3c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hg3c_ c.1.1.1 (C:) Triosephosphate isomerase {Pyrococcus woesei [TaxId: 2262]} aklkepiiainfktyieatgkraleiakaaekvyketgvtivvapqlvdlrmiaesveip vfaqhidpikpgshtghvlpeavkeagavgtllnhsenrmiladleaairraeevglmtm vcsnnpavsaavaalnpdyvaveppeligtgipvskakpevitntvelvkkvnpevkvlc gagistgedvkkaielgtvgvllasgvtkakdpekaiwdlvsgi
Timeline for d1hg3c_: