Lineage for d1hg3a_ (1hg3 A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 681099Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 681100Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 681101Protein Triosephosphate isomerase [51353] (17 species)
  7. 681102Species Archaeon Pyrococcus woesei [TaxId:2262] [63891] (1 PDB entry)
  8. 681103Domain d1hg3a_: 1hg3 A: [61025]

Details for d1hg3a_

PDB Entry: 1hg3 (more details), 2.7 Å

PDB Description: crystal structure of tetrameric tim from pyrococcus woesei.
PDB Compounds: (A:) triosephosphate isomerase

SCOP Domain Sequences for d1hg3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hg3a_ c.1.1.1 (A:) Triosephosphate isomerase {Archaeon Pyrococcus woesei [TaxId: 2262]}
aklkepiiainfktyieatgkraleiakaaekvyketgvtivvapqlvdlrmiaesveip
vfaqhidpikpgshtghvlpeavkeagavgtllnhsenrmiladleaairraeevglmtm
vcsnnpavsaavaalnpdyvaveppeligtgipvskakpevitntvelvkkvnpevkvlc
gagistgedvkkaielgtvgvllasgvtkakdpekaiwdlvsgi

SCOP Domain Coordinates for d1hg3a_:

Click to download the PDB-style file with coordinates for d1hg3a_.
(The format of our PDB-style files is described here.)

Timeline for d1hg3a_: