Lineage for d1hg3a_ (1hg3 A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 115905Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 115906Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 115907Protein Triosephosphate isomerase [51353] (13 species)
  7. 115908Species Archaeon Pyrococcus woesei [TaxId:2262] [63891] (1 PDB entry)
  8. 115909Domain d1hg3a_: 1hg3 A: [61025]

Details for d1hg3a_

PDB Entry: 1hg3 (more details), 2.7 Å

PDB Description: crystal structure of tetrameric tim from pyrococcus woesei.

SCOP Domain Sequences for d1hg3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hg3a_ c.1.1.1 (A:) Triosephosphate isomerase {Archaeon Pyrococcus woesei}
aklkepiiainfktyieatgkraleiakaaekvyketgvtivvapqlvdlrmiaesveip
vfaqhidpikpgshtghvlpeavkeagavgtllnhsenrmiladleaairraeevglmtm
vcsnnpavsaavaalnpdyvaveppeligtgipvskakpevitntvelvkkvnpevkvlc
gagistgedvkkaielgtvgvllasgvtkakdpekaiwdlvsgi

SCOP Domain Coordinates for d1hg3a_:

Click to download the PDB-style file with coordinates for d1hg3a_.
(The format of our PDB-style files is described here.)

Timeline for d1hg3a_: