Lineage for d1hg1c_ (1hg1 C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142620Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily)
    consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each
    Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5
    Domain 2 has parallel beta-sheet of 4 strands, order 1234
  4. 2142621Superfamily c.88.1: Glutaminase/Asparaginase [53774] (2 families) (S)
  5. 2142622Family c.88.1.1: Glutaminase/Asparaginase [53775] (4 protein domains)
    automatically mapped to Pfam PF00710
  6. 2142623Protein Asparaginase type II [53776] (5 species)
  7. 2142624Species Erwinia chrysanthemi [TaxId:556] [53779] (8 PDB entries)
  8. 2142643Domain d1hg1c_: 1hg1 C: [61022]
    complexed with das

Details for d1hg1c_

PDB Entry: 1hg1 (more details), 1.8 Å

PDB Description: x-ray structure of the complex between erwinia chrysanthemi l-asparaginase and d-aspartate
PDB Compounds: (C:) L-asparaginase

SCOPe Domain Sequences for d1hg1c_:

Sequence, based on SEQRES records: (download)

>d1hg1c_ c.88.1.1 (C:) Asparaginase type II {Erwinia chrysanthemi [TaxId: 556]}
lpnivilatggtiagsaatgtqttgykagalgvdtlinavpevkklanvkgeqfsnmase
nmtgdvvlklsqrvnellarddvdgvvithgtdtveesayflhltvksdkpvvfvaamrp
ataisadgpmnlleavrvagdkqsrgrgvmvvindrigsaryitktnastldtfraneeg
ylgviignriyyqnridklhttrsvfdvrgltslpkvdilygyqddpeylydaaiqhgvk
givyagmgagsvsvrgiagmrkalekgvvvmrstrtgngivppdeelpglvsdslnpaha
rillmlaltrtsdpkviqeyfhty

Sequence, based on observed residues (ATOM records): (download)

>d1hg1c_ c.88.1.1 (C:) Asparaginase type II {Erwinia chrysanthemi [TaxId: 556]}
lpnivilatggtiaglgvdtlinavpevkklanvkgeqfsnmasenmtgdvvlklsqrvn
ellarddvdgvvithgtdtveesayflhltvksdkpvvfvaamrpataisadgpmnllea
vrvagdkqsrgrgvmvvindrigsaryitktnastldtfraneegylgviignriyyqnr
idklhttrsvfdvrgltslpkvdilygyqddpeylydaaiqhgvkgivyagmgagsvsvr
giagmrkalekgvvvmrstrtgngivppdeelpglvsdslnpaharillmlaltrtsdpk
viqeyfhty

SCOPe Domain Coordinates for d1hg1c_:

Click to download the PDB-style file with coordinates for d1hg1c_.
(The format of our PDB-style files is described here.)

Timeline for d1hg1c_: