Lineage for d1hfof_ (1hfo F:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 134931Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
  4. 134932Superfamily d.80.1: Tautomerase/MIF [55331] (3 families) (S)
  5. 134993Family d.80.1.3: MIF-related [55339] (2 proteins)
  6. 134999Protein Microphage migration inhibition factor (MIF) [55340] (4 species)
  7. 135031Species Trichina (Trichinella spiralis) [64323] (1 PDB entry)
  8. 135037Domain d1hfof_: 1hfo F: [61011]

Details for d1hfof_

PDB Entry: 1hfo (more details), 1.65 Å

PDB Description: the structure of the macrophage migration inhibitory factor from trichinella spiralis.

SCOP Domain Sequences for d1hfof_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hfof_ d.80.1.3 (F:) Microphage migration inhibition factor (MIF) {Trichina (Trichinella spiralis)}
piftlntnikatdvpsdflsstsalvgnilskpgsyvavhintdqqlsfggstnpaafgt
lmsiggiepsrnrdhsaklfdhlntklgipknrmyihfvnlngddvgwngttf

SCOP Domain Coordinates for d1hfof_:

Click to download the PDB-style file with coordinates for d1hfof_.
(The format of our PDB-style files is described here.)

Timeline for d1hfof_: