SCOPe 2.04: Domain d1hf3a2: 1hf3 A:164-339

Lineage for d1hf3a2 (1hf3 A:164-339)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
   N-terminal all-beta domain defines family

6. Protein Alcohol dehydrogenase [51737] (9 species)

7. Species Horse (Equus caballus) [TaxId:9796] [51738] (40 PDB entries)
   Uniprot P00327

8. Domain d1hf3a2: 1hf3 A:164-339 [61001]
   Other proteins in same PDB: d1hf3a1, d1hf3b1
   complexed with cd, mrd, nad

Details for d1hf3a2

PDB Entry: 1hf3, 1.95 Å

PDB Description: atomic x-ray structure of liver alcohol dehydrogenase containing cadmium and a hydroxide adduct to nadh

PDB Compounds: (A:) alcohol dehydrogenase e chain

SCOPe Domain Sequences for d1hf3a2:

Sequence; same for both SEQRES and ATOM records:

>d1hf3a2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
splekvcligcgfstgygsavkvakvtqgstcavfglggvglsvimgckaagaariigvd
inkdkfakakevgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccq
eaygvsvivgvppdsqnlsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakk

Timeline for d1hf3a2:

• d1hf3a2 first appeared in SCOP 1.57
  
• d1hf3a2 appears in SCOPe 2.03
  
• d1hf3a2 appears in SCOPe 2.05
  
• d1hf3a2 appears in the current release, SCOPe 2.08