SCOP 1.57: Domain d1hf2d1: 1hf2 D:100-206

Lineage for d1hf2d1 (1hf2 D:100-206)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.80: Single-stranded right-handed beta-helix [51125] (3 superfamilies)

4. Superfamily b.80.3: Cell-division inhibitor MinC, C-terminal domain [63848] (1 family)

5. Family b.80.3.1: Cell-division inhibitor MinC, C-terminal domain [63849] (1 protein)
   this is a repeat family; one repeat unit is 1hf2 A:117-135 found in domain

6. Protein Cell-division inhibitor MinC, C-terminal domain [63850] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [63851] (1 PDB entry)

8. Domain d1hf2d1: 1hf2 D:100-206 [60998]
   Other proteins in same PDB: d1hf2a2, d1hf2b2, d1hf2c2, d1hf2d2

Details for d1hf2d1

PDB Entry: 1hf2, 2.2 Å

PDB Description: crystal structure of the bacterial cell-division inhibitor minc from t. maritima

SCOP Domain Sequences for d1hf2d1:

Sequence; same for both SEQRES and ATOM records:

>d1hf2d1 b.80.3.1 (D:100-206) Cell-division inhibitor MinC, C-terminal domain {Thermotoga maritima}
tgkvikrnirsgqtvvhsgdvivfgnvnkgaeilaggsvvvfgkaqgniraglneggqav
vaaldlqtsliqiagfithskgeenvpsiahvkgnriviepfdkvsf

Timeline for d1hf2d1:

• d1hf2d1 is new in SCOP 1.57
  
• d1hf2d1 appears in SCOP 1.59
  
• d1hf2d1 appears in the current release, SCOPe 2.08