Lineage for d1heze_ (1hez E:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1639448Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 1639449Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 1639450Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species)
  7. 1639451Species Peptostreptococcus magnus [TaxId:1260] [54363] (12 PDB entries)
  8. 1639470Domain d1heze_: 1hez E: [60991]
    Other proteins in same PDB: d1heza1, d1heza2, d1hezb1, d1hezb2, d1hezc1, d1hezc2, d1hezd1, d1hezd2
    domain X; res. 820-880
    complexed with imd

Details for d1heze_

PDB Entry: 1hez (more details), 2.7 Å

PDB Description: structure of p. magnus protein l bound to a human igm fab.
PDB Compounds: (E:) protein l

SCOPe Domain Sequences for d1heze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1heze_ d.15.7.1 (E:) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus [TaxId: 1260]}
evtikvnlifadgkiqtaefkgtfeeataeayryadllakvngeytadledggnhmnikf
a

SCOPe Domain Coordinates for d1heze_:

Click to download the PDB-style file with coordinates for d1heze_.
(The format of our PDB-style files is described here.)

Timeline for d1heze_: