SCOP 1.59: Domain d1heze_: 1hez E:

Lineage for d1heze_ (1hez E:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)

6. Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species)

7. Species Peptostreptococcus magnus [TaxId:1260] [54363] (10 PDB entries)

8. Domain d1heze_: 1hez E: [60991]
   Other proteins in same PDB: d1heza1, d1heza2, d1hezb1, d1hezb2, d1hezc1, d1hezc2, d1hezd1, d1hezd2

Details for d1heze_

PDB Entry: 1hez, 2.7 Å

PDB Description: structure of p. magnus protein l bound to a human igm fab.

SCOP Domain Sequences for d1heze_:

Sequence; same for both SEQRES and ATOM records:

>d1heze_ d.15.7.1 (E:) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus}
evtikvnlifadgkiqtaefkgtfeeataeayryadllakvngeytadledggnhmnikf
a

Timeline for d1heze_:

• d1heze_ first appeared in SCOP 1.57
  
• d1heze_ appears in SCOP 1.61
  
• d1heze_ appears in the current release, SCOPe 2.08