Lineage for d1heze_ (1hez E:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77788Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 78181Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 78182Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)
  6. 78183Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species)
  7. 78184Species Peptostreptococcus magnus [TaxId:1260] [54363] (4 PDB entries)
  8. 78190Domain d1heze_: 1hez E: [60991]
    Other proteins in same PDB: d1heza1, d1heza2, d1hezb1, d1hezb2, d1hezc1, d1hezc2, d1hezd1, d1hezd2

Details for d1heze_

PDB Entry: 1hez (more details), 2.7 Å

PDB Description: antibody-antigen complex

SCOP Domain Sequences for d1heze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1heze_ d.15.7.1 (E:) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus}
evtikvnlifadgkiqtaefkgtfeeataeayryadllakvngeytadledggnhmnikf
a

SCOP Domain Coordinates for d1heze_:

Click to download the PDB-style file with coordinates for d1heze_.
(The format of our PDB-style files is described here.)

Timeline for d1heze_: