SCOPe 2.02: Domain d1hezd2: 1hez D:122-224

Lineage for d1hezd2 (1hez D:122-224)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain mu constant domain 1, CH1-mu [88582] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88583] (7 PDB entries)

8. Domain d1hezd2: 1hez D:122-224 [60990]
   Other proteins in same PDB: d1heza1, d1heza2, d1hezb1, d1hezc1, d1hezc2, d1hezd1, d1heze_
   part of IgM rheumatoid factor Fab
   complexed with imd

Details for d1hezd2

PDB Entry: 1hez, 2.7 Å

PDB Description: antibody-antigen complex

PDB Compounds: (D:) heavy chain of ig

SCOPe Domain Sequences for d1hezd2:

Sequence, based on SEQRES records:

>d1hezd2 b.1.1.2 (D:122-224) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]}
gsasaptlfplvscensnpsstvavgclaqdflpdsitfswkyknnsdisstrgfpsvlr
ggkyaatsqvllpskdvaqgtnehvvckvqhpngnkekdvplp

Sequence, based on observed residues (ATOM records):

>d1hezd2 b.1.1.2 (D:122-224) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]}
gsasaptlfplvscenstvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggky
aatsqvllpsnehvvckvqhpngnkekdvplp

Timeline for d1hezd2:

• d1hezd2 first appeared in SCOP 1.57
  
• d1hezd2 appears in SCOPe 2.01
  
• d1hezd2 appears in SCOPe 2.03
  
• d1hezd2 appears in the current release, SCOPe 2.07