Lineage for d1hezd1 (1hez D:1-121)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510447Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1510625Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (33 PDB entries)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)
  8. 1510674Domain d1hezd1: 1hez D:1-121 [60989]
    Other proteins in same PDB: d1heza1, d1heza2, d1hezb2, d1hezc1, d1hezc2, d1hezd2, d1heze_
    part of IgM RF 2A2
    complexed with imd

Details for d1hezd1

PDB Entry: 1hez (more details), 2.7 Å

PDB Description: structure of p. magnus protein l bound to a human igm fab.
PDB Compounds: (D:) heavy chain of ig

SCOPe Domain Sequences for d1hezd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hezd1 b.1.1.1 (D:1-121) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
qvqlvesgggvvqpgrslrlscaasgftfsgygmhwvrqapgkglewvalisydesnkyy
adsvkgrftisrdnskntlylqmnslraedtavyycakvkfydptapndywgqgtlvtvs
s

SCOPe Domain Coordinates for d1hezd1:

Click to download the PDB-style file with coordinates for d1hezd1.
(The format of our PDB-style files is described here.)

Timeline for d1hezd1: