Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
Species Fab of human IgM RF 2A2 [48896] (2 PDB entries) |
Domain d1hezc1: 1hez C:1-107 [60987] Other proteins in same PDB: d1heza2, d1hezb2, d1hezc2, d1hezd2, d1heze_ |
PDB Entry: 1hez (more details), 2.7 Å
SCOP Domain Sequences for d1hezc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hezc1 b.1.1.1 (C:1-107) Immunoglobulin (variable domains of L and H chains) {Fab of human IgM RF 2A2} diqmtqspsslsasvgdrvtitcrtsqsissylnwyqqkpgkapklliyaasslqsgvps rfsgsgsgtdftltisslqpedfatyycqqsystprtfgqgtkveik
Timeline for d1hezc1: